Products
-
SARS-CoV-2
-
Biosimilar Catalogue
-
Customized Media
<
>
Description
InformationCat log number: TSC-002
Amount: 100 ug / vial Price: US$ 200 per vial |
Recombinant SARS-CoV-2 Spike Receptor Binding DomainSpecies
SARS-CoV-2 Host Species E.coli MW 22 kDa Genbank # QHR63250.1 Supplied As Aqueous buffer solution Storage At –80°C. Synonym(s) SARS-CoV-2 spike RBD, novel coronavirus spike RBD, nCoV spike RBD, covid, covid-19, 100687-2, 2019-nCoV Formulation PBS 7.4, 5%glycerol Warnings Avoid freeze/thaw cycles. Scientific Category Coronavirus |
Description
The protein has an amino acid sequence that is identical to the natural sequence predicted from human DNA sequence analysis‚ except for the addition of an N-terminal Glycine necessary for expression in E coli. Because G-filgrastim is produced in E coli‚ the product is non-glycosylate. It works by stimulating the body to increase neutrophil production. Information Cat Log Number: TSC-003 Amount: 100ug/vial Price: USD 1,200 |
Species
G-filgrastim Host Species E.coli MW 18.7 kDa Sequences GTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP (*Tag Free) UniProtKB P09919 Supplied As Aqueous buffer solution Storage At –80°C. Synonym(s) Neupogen, Granix, Zarxio , G-CSF, granulocyte-colony stimulating factor Formulation PBS 7.4, 5%glycerol Warnings Avoid freeze/thaw cycles. Scientific Category Cytokine |
In-house Cultural Media and Customized Media Design
- Taron Solutions offers our platform culture media for both mammalian and microbial systems
- Taron Solutions can offer custom service for cell culture media according to project requirement.
- Rational Culture Media Design leverages Taron Solutions focus on cell culture science and process knowledge to construct rational experiments that aim to reach a target medium's end goals
|
Our Competitive Edge
- Fast development platform derived from years of experience and expertise
- Our media is priced competitively against current international suppliers with equal or better performance
- Takes advantage of project management to facilitate efficient planning, coordination and big picture view
- We aim to apply our continually growing knowledge-base to solve specific problems through targeted hypothesis testing rather than trying many variables and seeing what sticks
- Development goals defined beforehand - performance, regulatory, and other needs
- Multi-dimensional approach that utilizes several complementary methods, rather than overcommitting to any single method of media development
Information
Ecoli based media:
Cat Log Number: TSC-004
Amount: 1 kg - 25 kg (Per Request)
Specification: Basal and feed? GMP grade or non-GMP?
Price: Please contact Taron Solutions for a quote
Mammalian based media (CHO)
Cat Log Number: TSC-005
Amount: 1 kg - 25 kg (Per Request)
Specification:
Price: Please contact Taron Solutions for a quote
Ecoli based media:
Cat Log Number: TSC-004
Amount: 1 kg - 25 kg (Per Request)
Specification: Basal and feed? GMP grade or non-GMP?
Price: Please contact Taron Solutions for a quote
Mammalian based media (CHO)
Cat Log Number: TSC-005
Amount: 1 kg - 25 kg (Per Request)
Specification:
Price: Please contact Taron Solutions for a quote