Products
-
SARS-CoV-2
-
G-filgrastim
<
>
Description
InformationCat log number: TSC-002
Amount: 100 ug / vial Price: US$ 200 per vial |
Recombinant SARS-CoV-2 Spike Receptor Binding DomainSpecies
SARS-CoV-2 Host Species E.coli MW 22 kDa Genbank # QHR63250.1 Supplied As Aqueous buffer solution Storage At –80°C. Synonym(s) SARS-CoV-2 spike RBD, novel coronavirus spike RBD, nCoV spike RBD, covid, covid-19, 100687-2, 2019-nCoV Formulation PBS 7.4, 5%glycerol Warnings Avoid freeze/thaw cycles. Scientific Category Coronavirus |
Description
The protein has an amino acid sequence that is identical to the natural sequence predicted from human DNA sequence analysis‚ except for the addition of an N-terminal Glycine necessary for expression in E coli. Because G-filgrastim is produced in E coli‚ the product is non-glycosylate. It works by stimulating the body to increase neutrophil production. Information Cat Log Number: TSC-003 Amount: 100ug/vial Price: USD 1,200 |
Species
G-filgrastim Host Species E.coli MW 18.7 kDa Sequences GTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP (*Tag Free) UniProtKB P09919 Supplied As Aqueous buffer solution Storage At –80°C. Synonym(s) Neupogen, Granix, Zarxio , G-CSF, granulocyte-colony stimulating factor Formulation PBS 7.4, 5%glycerol Warnings Avoid freeze/thaw cycles. Scientific Category Cytokine |